PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03220.1.g00040.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 383aa    MW: 41063.7 Da    PI: 6.8917
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03220.1.g00040.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-18114166456
                                   -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   +++++ +q+++Le+ Fe  +++  e++++LA+ lgL+ rqV +WFqNrRa++k
  Zpz_sc03220.1.g00040.1.am.mk 114 KRRLSVDQVRTLERSFEVANKLEPERKAQLARALGLQPRQVAIWFQNRRARWK 166
                                   447999**********************************************9 PP

2HD-ZIP_I/II1261.7e-40112203192
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   e+krrls +qv++LE+sFe  +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+aL+r++da ++en++L 
  Zpz_sc03220.1.g00040.1.am.mk 112 ERKRRLSVDQVRTLERSFEVANKLEPERKAQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALRRQLDAARTENDALL 192
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreelk 92 
                                   +++++L++el+
  Zpz_sc03220.1.g00040.1.am.mk 193 AQNKKLHAELA 203
                                   *******9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-1987169IPR009057Homeodomain-like
SMARTSM003892.6E-18111172IPR001356Homeobox domain
SuperFamilySSF466891.11E-18111170IPR009057Homeodomain-like
PROSITE profilePS5007116.714112168IPR001356Homeobox domain
CDDcd000861.65E-16113169No hitNo description
PfamPF000469.2E-16114166IPR001356Homeobox domain
PRINTSPR000315.9E-6139148IPR000047Helix-turn-helix motif
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
PRINTSPR000315.9E-6148164IPR000047Helix-turn-helix motif
PfamPF021833.1E-9168203IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MKPMATNGMA PSFFPANFLL QMQQPLPHHH HHPQQQDHPH HHDHEQHLLA PPPPSLSPIL  60
HGFAGAMAPP PMYPPDAGVS NDLHAEPPQQ QDGDAASDDE EGSAAAGGCV GERKRRLSVD  120
QVRTLERSFE VANKLEPERK AQLARALGLQ PRQVAIWFQN RRARWKTKQL EKDYDALRRQ  180
LDAARTENDA LLAQNKKLHA ELAKRRSWSR LESVRVGIGA GHMNTGPPVG HPCTARSIMA  240
LKGGGDGGGG GRQEAASELI NLNVKETEAS CSNRSENSSE INLDISRPAP AAEESPMNSH  300
RAAALPFYAS AVGGRSGGGG GSSLDIDQLL QHNHASPKME LGHGGGADTA GAAVSFGSLL  360
CGGAVVDEQP PFWPWAADGH NFQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111116ERKRRL
2160168RRARWKTKQ
3241251KGGGDGGGGGR
4312320GGRSGGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7284121e-107KJ728412.1 Zea mays clone pUT6717 HB transcription factor (HB98) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983144.11e-125PREDICTED: homeobox-leucine zipper protein HOX23-like
SwissprotA2Z7342e-93HOX23_ORYSI; Homeobox-leucine zipper protein HOX23
SwissprotQ94GL52e-93HOX23_ORYSJ; Homeobox-leucine zipper protein HOX23
TrEMBLC5WM881e-124C5WM88_SORBI; Putative uncharacterized protein Sb01g022420
STRINGSb01g022420.11e-124(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.15e-50HD-ZIP family protein